Write
List write
-
write to cj atplease help us find the ownerswe found 2 sweet doggies on our porch last nightwe would like proof of ownership
-
Retails for if you would be interested in this dress feel free to write me here or you can call/text me atasking this dress has 3/4 lacey sleeves, sequence in the right places, and it s a -line gown, im also including a wedding veil if neededi have a beautiful brand new plus sized 26w wedding gown, brand new, never worn (only to try on) ended up buying a different gown this gown needs to go soon
$ 300
-
You can write to all of the kids on your list as often as you want to for years to comeyou can spread the fun around and send letters to friends and other family members too!now you can answer your kids letters to santa claus with exactly the answers you want them to have on beautiful high quality santa claus stationaryprintable santa letters make it easy and affordable to create and send a christmas letter from santa to every child in your family
$ 39
-
write down the item number 3select the number of print you would like made and then place you order @ or call for a quote on your order just its that easycom its easy to do 1browse though the print you would like 2hey hey hey!!!!!! the website is up @ www
$ 9
-
write down the item number 3com its easy to do 1browse though the print you would like 2hey hey hey!!!!!! the website is up @ wwwselect the number of print you would like made and then place you order @ or call for a quote on your order just its that easy
$ 9
-
Call dana at or sam at or write my email and other miscs a craftsman industrial quality older drill press in perfict working orderif you buy more then one item the price comes downlanda psi hot water pressure washer, desel fired boiler, gas powered pump 50ft of hose the wand and extra tips it was twenty four hundred new, this machine runs exelant and has been kept very clean and well maintained a steal at then we have a chicago watt watt electric start generator v outlet v outlets and 2-12v outlets it was also kept in really good condition,serviced, and maintained has approx 120 hrs on it a great buy at then we have a green lee 24" x 24" by 48" construction quality tool box in great shape also a latter or lumber rack fore a full size pick up very good condition
$ 4500025000150
-
Html vendors using eventbrite pays $ includes fee mail in check for $89, on entry form, write in $10 off from lynn harris free lunch laurel park place livonia, michigan march 7 & oct 10 oakland mall troy, michigan march 14 & oct 24 wwwmichigancraftersmarketplace
-
Let letter teddy write a special letter for your special loved onegive your loved one a gift to keep for a lifetimecome see us at wwwsend them a teddy bear with a personalized letter or cardteddybearsletters
-
General features: microsd to sd card adapter built-in write protection switch also works with microsdhc and microsdxc cards for use in devices with a standard secure digital slot unit dimensions: 11-inches (h x w x d, approximate) notes: microsd card is for picture representational purposes only product requirements: microsd memory card device with a standard secure digital slot shop online at jebsboutique & always free shipping
$ 5
-
If you want to try it out or ask me more about it please writeit is like new condition and has not been used muchit is worth over a $ dollars newit would make someone a great guitarjust isn't played so the owner doesn't need it gathering dustnothing is wrong with this guitar it is in min condition comes with the casei will through in a strap and cord for amphi music men and women; i am selling this guitar for a friend of mineit is a washburn
$ 850
-
Please call or write if you have any questions or to set up an appointment to see it middleburg heightsthis chippendale style mahogany chest is in a like-new condition with little signs of wearpick-up only, no shippingit measures 56" tall, 37" wide and 21" deep
$ 695
-
Also many stles available for boys website information will be available soon for store opening on many item for "baby bubbles and friends" you can write for information or continue to follow on facebookbaby bubbles 100% cotton tee-shirt for girls sizes 2t-5t
$ 9
-
This is a set of 4 adapters we only accept paypal payment we do no ship international description sd card adapter built-in write protection switch for use in devices with a standard secure digital slot sd card adapter generic, with retail packaging will hold thousands of images or songs!
$ 6
-
Price: $22 write or come in today to: scientology information center hollywood boulevard, los angeles, ca dianetics the original thesis by lron hubbard dianetics is the only science of the mind built upon axiomsworkability rather than idealism has been consultedjust get, read it and try it, and you'll never be the same
$ 22
-
Price: $ including tax write today to: the church of scientology of los angeles dianetics is the only science of the mind built upon axiomsworkability rather than idealism has been consultedthis is the road to a better life with fewer problemsjust get it, read it and try it, and you'll never be the same
$ 22
-
Minolta xg-1 + tele md+ vivitar mc 2x tele converter + vivitar flash with all manuals -call or write make offer
-
Please write an honest review as to give me your opinionplease join me in celebrating my 24th recipe book “sandwiches and spreads” you can download it for free at: http://wwwcom/s/ref=nb_sb_noss?url=search-alias%3ddigital-text&field-keywords=sandwiches+and+spreads&rh=n%3a%2ck%3asandwiches we have also published many other recipe books re: bread, pork, vegetables, seafood,, beef, ground beef, chicken, pasta, pies, martinis, fruit, cakes, pies, appertizers and many others…all priced at only $2 please enjoy, mary owens
-
Please write an honest review as to give me your opinioncom/s/ref=nb_sb_noss?url=search-alias%3ddigital-text&field-keywords=sandwiches+and+spreads&rh=n%3a%2ck%3asandwiches we have also published many other recipe books re: bread, pork, vegetables, seafood, pork, seafood, beef, ground beef, poultry, pasta, pies, martinis, fruit and many others…all priced at only $2please join me in celebrating my 24th recipe book “sandwiches and spreads” you can download it for free at: http://www please enjoy, mary owens
-
Html or write to us at [email protected] or call us now at +91 contact no: +91 contact address: #123,teachers colony,5th main, koramangala 1st block, bangalore - , karnataka, india get best collection of makeup products online, your favourite l'oreal paris lucent magique blush, buy more beauty products online india available cash on delivery, for more information, visit at http://wwwcom/l-oreal-paris-lucent-magique-blush-sunset-glow-04
$ 870
-
If she could write a gossip column that's what she would be best atmeet sprinkles who is a busy girl with lots of things to see and doshe isn't a lap girl but she is sure to keep you entertained and you will never forget she's around!!she just never stops and loves to explore and see what's going on
-
Has 5 months for more info and pics write me via email: beauritul blue nose pit lady
$ 300
-
The love of my life, had her for many years, smart,beautiful green eyes and gentle nature please call or write lost orange catlast seen just off 40 by blackley streetshe knows her nametook an unknown ride till it was too late to retrieve hersomeone will pick her up for mepo box 55 gosport,in
-
No choice here, must be picked up by yourself with two strong persons ! give me an offer ! please write and please do not callcollector's itemthis item still works
$ 20
-
Buy this item for $ and get the lg compact colour cell phone (see other ad) for free ! just pay shipping costs for cell phone, if cell phone desired to be shipped ! no choice here, must be picked up by yourself with two strong persons ! give me an offer ! please write and please do not callcollector's itemthis item still works
$ 20
-
Must come to get it by yourself ! please write and please do not call !slightly old, but works well
$ 40
-
We only accept payment with paypal we do not ship international high speed 512mb compact flash memory card 512mb high speed (cf) compact flash memory card minimum of 20mb/s sequential read speed for ultra-fast image viewing and data transfer minimum 10mb/s sequential write speed lets you capture large image files faster memory capacity: 512mb plug and play format
$ 5
-
50 tb (native)/3best prices being offered on dell ofhmtn and all lto5 media tapes0 tb (compressed) drive supported : lto ultrium 5 (read/write) labeled : no5 and 3 terabyte enjoy best discount offer all worldwide fast shipping from https://wwwphp specification manufacturer : dell part number : ofhmtn product name : ultrium lto-5 data cartridge product type : data cartridge technical information tape technology : lto ultrium - lto-5 storage capacity : 1data capacity of single ultrium dell lto-5 tape is 1
$ 26
-
Please write or call -- or -- all ready for your love and attentionthey have had all their shots and wormed
$ 200
-
Please write for detailsvery warm, waterproof, flame retardant and in excellent conditionretails for almost $900 selling for $120selling a size large extreme weather helly hanson suit
$ 120